arginase-1 long peptide vaccine

{
  "id": "MLC-T-ONC-011225",
  "term": "arginase-1 long peptide vaccine",
  "field": "Oncology and biomedicine",
  "definition": "A peptide cancer vaccine comprised of a long peptide, amino acid 169 through 206 (ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL), obtained from arginase-1, with potential immunomodulating and antineoplastic activities. Upon vaccination, the arginase-1 long peptide vaccine may activate the immune system to induce a cytotoxic T lymphocytes (CTLs)-mediated immune response against arginase-1-expressing cells. Arginase-1 is expressed by some cancer cells and by immune inhibitory cells, such as myeloid-derived suppressor cells (MDSCs) and tumor-associated macrophages (TAMs); its expression is associated with poor prognosis.",
  "synonyms": [
    "ARG-1 peptide vaccine",
    "ARGLong2",
    "ArgLong2(169-206) peptide vaccine"
  ],
  "references": [
    "National Cancer Institute Thesaurus"
  ],
  "url": "https://mlchart.com/terminology/oncology/arginase-1-long-peptide-vaccine/"
}